PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00922.1.p
Common NameEUGRSUZ_J00922, LOC104421655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 320aa    MW: 35338.4 Da    PI: 9.5853
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00922.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.59.2e-19228261134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  Eucgr.J00922.1.p 228 CMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGR 261
                       99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.899222258IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-16222272IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.85E-15225285No hitNo description
Gene3DG3DSA:3.30.50.102.1E-14226259IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.44E-14227274No hitNo description
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
PfamPF003201.3E-16228261IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSKKKIDFVG SWIFDDNVNG SSDEFFDNVL KQIDFPLEDV EGNILSDDWD ASFQLLELPS  60
SDVLEGFPSS YCGKKCEDIS APDRSLSRNE DKAKVKASPS YTETNSNRSI CHHQTSNDKD  120
SSLENSSSGS IENSLLFSSK SLIPVKRPRS KRLRPQTPKT RFNFPFASSA SSASGIYHPL  180
AASRSSSEGR HTKKSSGKRK GKEKNLHLLS GAEEMNSASQ NPSATRKCMH CEVTKTPQWR  240
EGPMGPKTLC NACGVRYRSG RLFPEYRPAA SPTFISSLHS NSHRKVIEMR KNGNHESGFA  300
SMNNLRHPQV RMSDGGVPV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBMTransfer from AT1G08000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00922.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031983.10.0PREDICTED: GATA transcription factor 10-like isoform X1
TrEMBLA0A059AC230.0A0A059AC23_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-47GATA transcription factor 11